BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravaind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 1LFU M.musculus DNA-binding protein (82 letters) Database: nr27062005 2,540,612 sequences; 863,360,394 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value gi|57111599|ref|XP_545786.1| PREDICTED: similar to Pre-B-cell le... 168 3e-41 gi|57094790|ref|XP_538847.1| PREDICTED: similar to notch4 [Canis... 165 4e-40 gi|339895|gb|AAA36764.1| E2A/PRL fusion protein 164 6e-40 gi|47220028|emb|CAG12176.1| unnamed protein product [Tetraodon n... 159 3e-38 gi|46048897|ref|NP_990077.1| PBX1A protein [Gallus gallus] >gnl|... 155 2e-37 gi|34365779|ref|NP_899198.1| pre B-cell leukemia transcription f... 155 3e-37 gi|50795297|ref|XP_423764.1| PREDICTED: similar to pre-B-cell le... 153 1e-36 gi|55588664|ref|XP_513961.1| PREDICTED: hypothetical protein XP_... 152 2e-36 gi|30584839|gb|AAP36672.1| Homo sapiens pre-B-cell leukemia tran... 152 2e-36 gi|30582249|gb|AAP35351.1| pre-B-cell leukemia transcription fac... 152 3e-36 gi|8096557|dbj|BAA96136.1| PBX1B [Gallus gallus] 151 4e-36 gi|47507441|gb|AAH71048.1| MGC83856 protein [Xenopus laevis] 151 6e-36 gi|107390|pir||B33061 homeotic protein prl - human >gnl|BL_ORD_I... 151 7e-36 gi|61868690|ref|XP_612645.1| PREDICTED: similar to Pre-B-cell le... 151 7e-36 gi|7160800|emb|CAB76458.1| Pbx4/Lazarus homeodomain protein [Dan... 150 7e-36 gi|47228232|emb|CAG07627.1| unnamed protein product [Tetraodon n... 149 2e-35 gi|56388825|gb|AAH87615.1| Pre B-cell leukemia transcription fac... 149 2e-35 gi|8567384|ref|NP_059491.1| pre B-cell leukemia transcription fa... 149 2e-35 gi|50657366|ref|NP_001002828.1| pre-B-cell leukemia transcriptio... 149 2e-35 gi|20302859|gb|AAM18914.1| pre-B-cell leukemia transcription fac... 149 3e-35 >gi|57111599|ref|XP_545786.1| PREDICTED: similar to Pre-B-cell leukemia transcription factor-1 (Homeobox protein PBX1) [Canis familiaris] Length = 1618 Score = 168 bits (426), Expect = 3e-41, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 903 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 962 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 963 KNIGKFQEEANIYAAKTAVTA 983 >gi|57094790|ref|XP_538847.1| PREDICTED: similar to notch4 [Canis familiaris] Length = 2224 Score = 165 bits (417), Expect = 4e-40, Method: Composition-based stats. Identities = 75/80 (93%), Positives = 78/80 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 2000 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 2059 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 2060 KNIGKFQEEANIYAVKTAVS 2079 >gi|339895|gb|AAA36764.1| E2A/PRL fusion protein Length = 550 Score = 164 bits (415), Expect = 6e-40, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 353 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 412 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 413 KNIGKFQEEANIYAAKTAVTA 433 >gi|47220028|emb|CAG12176.1| unnamed protein product [Tetraodon nigroviridis] Length = 509 Score = 159 bits (401), Expect = 3e-38, Method: Composition-based stats. Identities = 76/81 (93%), Positives = 78/81 (96%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 231 ARRKRRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 290 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEAN+YA KTAV A Sbjct: 291 KNIGKFQEEANLYAVKTAVDA 311 >gi|46048897|ref|NP_990077.1| PBX1A protein [Gallus gallus] PBX1A [Gallus gallus] Length = 430 Score = 155 bits (393), Expect = 2e-37, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 233 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 292 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 293 KNIGKFQEEANIYAAKTAVTA 313 >gi|34365779|ref|NP_899198.1| pre B-cell leukemia transcription factor 1 isoform a [Mus musculus] PREDICTED: similar to Pre-B-cell leukemia transcription factor-1 (Homeobox protein PBX1) [Rattus norvegicus] pre-B-cell leukemia transcription factor 1 [Homo sapiens] pre-B-cell leukemia transcription factor 1 [Homo sapiens] pre-B-cell leukemia transcription factor 1 [Homo sapiens] Pre B-cell leukemia transcription factor 1, isoform a [Mus musculus] Pre-B-cell leukemia transcription factor-1 (Homeobox protein PBX1) Pre-B-cell leukemia transcription factor-1 (Homeobox protein PBX1) (Homeobox protein PRL) PBX1 [Homo sapiens] pre-B-cell leukemia transcription factor 1 [Homo sapiens] PBX1a [Mus musculus] PBX1a Length = 430 Score = 155 bits (392), Expect = 3e-37, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 233 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 292 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 293 KNIGKFQEEANIYAAKTAVTA 313 >gi|50795297|ref|XP_423764.1| PREDICTED: similar to pre-B-cell leukemia transcription factor 3 [Gallus gallus] Length = 431 Score = 153 bits (386), Expect = 1e-36, Method: Composition-based stats. Identities = 76/81 (93%), Positives = 79/81 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 238 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKGGITVSQVSNWFGNKRIRYK 297 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KN+GKFQEEANIYAAKTAV A Sbjct: 298 KNMGKFQEEANIYAAKTAVDA 318 >gi|55588664|ref|XP_513961.1| PREDICTED: hypothetical protein XP_513961 [Pan troglodytes] Length = 351 Score = 152 bits (385), Expect = 2e-36, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 128 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 187 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 188 KNIGKFQEEANIYAAKTAVTA 208 >gi|30584839|gb|AAP36672.1| Homo sapiens pre-B-cell leukemia transcription factor 1 [synthetic construct] Length = 348 Score = 152 bits (385), Expect = 2e-36, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 233 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 292 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 293 KNIGKFQEEANIYAAKTAVTA 313 >gi|30582249|gb|AAP35351.1| pre-B-cell leukemia transcription factor 1 [Homo sapiens] pre B-cell leukemia transcription factor 1 isoform b [Mus musculus] pre-B-cell leukemia transcription factor 1 [Homo sapiens] pre-B-cell leukemia transcription factor 1 [Homo sapiens] PBX1b [Mus musculus] homeobox protein Length = 347 Score = 152 bits (384), Expect = 3e-36, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 233 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 292 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 293 KNIGKFQEEANIYAAKTAVTA 313 >gi|8096557|dbj|BAA96136.1| PBX1B [Gallus gallus] Length = 347 Score = 151 bits (382), Expect = 4e-36, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 233 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 292 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 293 KNIGKFQEEANIYAAKTAVTA 313 >gi|47507441|gb|AAH71048.1| MGC83856 protein [Xenopus laevis] Length = 445 Score = 151 bits (381), Expect = 6e-36, Method: Composition-based stats. Identities = 74/80 (92%), Positives = 77/80 (96%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK ITVSQVSNWFGNKRIRYK Sbjct: 237 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYK 296 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 297 KNIGKFQEEANIYAVKTAVS 316 >gi|107390|pir||B33061 homeotic protein prl - human homeobox-containing protein Length = 342 Score = 151 bits (381), Expect = 7e-36, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 145 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 204 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 205 KNIGKFQEEANIYAAKTAVTA 225 >gi|61868690|ref|XP_612645.1| PREDICTED: similar to Pre-B-cell leukemia transcription factor-1 (Homeobox protein PBX1) [Bos taurus] Length = 333 Score = 151 bits (381), Expect = 7e-36, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 233 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 292 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 293 KNIGKFQEEANIYAAKTAVTA 313 >gi|7160800|emb|CAB76458.1| Pbx4/Lazarus homeodomain protein [Danio rerio] Pbx4 homeodomain protein [Danio rerio] pre-B-cell leukemia transcription factor 4 [Danio rerio] Length = 343 Score = 150 bits (380), Expect = 7e-36, Method: Composition-based stats. Identities = 76/81 (93%), Positives = 78/81 (96%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 231 ARRKRRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 290 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEAN+YA KTAV A Sbjct: 291 KNIGKFQEEANLYAVKTAVDA 311 >gi|47228232|emb|CAG07627.1| unnamed protein product [Tetraodon nigroviridis] Length = 338 Score = 149 bits (377), Expect = 2e-35, Method: Composition-based stats. Identities = 72/78 (92%), Positives = 77/78 (98%) Query: 5 KRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYKKNI 64 +RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITV+QVSNWFGNKRIRYKKNI Sbjct: 144 QRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVAQVSNWFGNKRIRYKKNI 203 Query: 65 GKFQEEANIYAAKTAVTA 82 GKFQEEAN+YAA+TAV+A Sbjct: 204 GKFQEEANMYAARTAVSA 221 >gi|56388825|gb|AAH87615.1| Pre B-cell leukemia transcription factor 2 [Mus musculus] Length = 430 Score = 149 bits (377), Expect = 2e-35, Method: Composition-based stats. Identities = 75/80 (93%), Positives = 78/80 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 244 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 303 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 304 KNIGKFQEEANIYAVKTAVS 323 >gi|8567384|ref|NP_059491.1| pre B-cell leukemia transcription factor 2 [Mus musculus] PBX2 [Mus musculus] Pre B-cell leukemia transcription factor 2 [Mus musculus] Pre B-cell leukemia transcription factor 2 [Mus musculus] Pre-B-cell leukemia transcription factor-2 (Homeobox protein PBX2) PBX2 [Mus musculus] Length = 430 Score = 149 bits (377), Expect = 2e-35, Method: Composition-based stats. Identities = 75/80 (93%), Positives = 78/80 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 244 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 303 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 304 KNIGKFQEEANIYAVKTAVS 323 >gi|50657366|ref|NP_001002828.1| pre-B-cell leukemia transcription factor 2 [Rattus norvegicus] pre-B-cell leukemia transcription factor 2 [Rattus norvegicus] Length = 430 Score = 149 bits (376), Expect = 2e-35, Method: Composition-based stats. Identities = 75/80 (93%), Positives = 78/80 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 244 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 303 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 304 KNIGKFQEEANIYAVKTAVS 323 >gi|20302859|gb|AAM18914.1| pre-B-cell leukemia transcription factor 1b [Xenopus laevis] Length = 347 Score = 149 bits (375), Expect = 3e-35, Method: Composition-based stats. Identities = 78/81 (96%), Positives = 78/81 (96%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK ITVSQVSNWFGNKRIRYK Sbjct: 233 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCAITVSQVSNWFGNKRIRYK 292 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAV A Sbjct: 293 KNIGKFQEEANIYAAKTAVNA 313 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: gi|57111599|ref|XP_545786.1| PREDICTED: similar to Pre-B-cell le... 184 7e-46 gi|339895|gb|AAA36764.1| E2A/PRL fusion protein 184 7e-46 gi|57094790|ref|XP_538847.1| PREDICTED: similar to notch4 [Canis... 181 4e-45 gi|47220028|emb|CAG12176.1| unnamed protein product [Tetraodon n... 180 1e-44 gi|47507441|gb|AAH71048.1| MGC83856 protein [Xenopus laevis] 173 1e-42 gi|50795297|ref|XP_423764.1| PREDICTED: similar to pre-B-cell le... 173 1e-42 gi|46048897|ref|NP_990077.1| PBX1A protein [Gallus gallus] >gnl|... 173 1e-42 gi|34365779|ref|NP_899198.1| pre B-cell leukemia transcription f... 172 2e-42 gi|56388825|gb|AAH87615.1| Pre B-cell leukemia transcription fac... 171 5e-42 gi|8567384|ref|NP_059491.1| pre B-cell leukemia transcription fa... 171 5e-42 gi|50657366|ref|NP_001002828.1| pre-B-cell leukemia transcriptio... 171 6e-42 gi|7160800|emb|CAB76458.1| Pbx4/Lazarus homeodomain protein [Dan... 170 7e-42 gi|47228232|emb|CAG07627.1| unnamed protein product [Tetraodon n... 170 1e-41 gi|7160798|emb|CAB76457.1| pbxy homeodomain protein [Danio rerio... 170 1e-41 gi|55626238|ref|XP_518378.1| PREDICTED: similar to Pre-B-cell le... 169 2e-41 gi|55588664|ref|XP_513961.1| PREDICTED: hypothetical protein XP_... 169 2e-41 gi|47207681|emb|CAF91499.1| unnamed protein product [Tetraodon n... 169 2e-41 gi|31228972|ref|XP_318146.1| ENSANGP00000020686 [Anopheles gambi... 169 2e-41 gi|7160792|emb|CAB76454.1| Pbx1a homeodomain protein [Danio reri... 169 2e-41 gi|35313|emb|CAA42503.1| homeobox protein [Homo sapiens] 169 2e-41 Sequences not found previously or not previously below threshold: >gi|57111599|ref|XP_545786.1| PREDICTED: similar to Pre-B-cell leukemia transcription factor-1 (Homeobox protein PBX1) [Canis familiaris] Length = 1618 Score = 184 bits (467), Expect = 7e-46, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 903 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 962 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 963 KNIGKFQEEANIYAAKTAVTA 983 >gi|339895|gb|AAA36764.1| E2A/PRL fusion protein Length = 550 Score = 184 bits (467), Expect = 7e-46, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 353 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 412 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 413 KNIGKFQEEANIYAAKTAVTA 433 >gi|57094790|ref|XP_538847.1| PREDICTED: similar to notch4 [Canis familiaris] Length = 2224 Score = 181 bits (460), Expect = 4e-45, Method: Composition-based stats. Identities = 75/80 (93%), Positives = 78/80 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 2000 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 2059 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 2060 KNIGKFQEEANIYAVKTAVS 2079 >gi|47220028|emb|CAG12176.1| unnamed protein product [Tetraodon nigroviridis] Length = 509 Score = 180 bits (456), Expect = 1e-44, Method: Composition-based stats. Identities = 76/81 (93%), Positives = 78/81 (96%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 231 ARRKRRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 290 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEAN+YA KTAV A Sbjct: 291 KNIGKFQEEANLYAVKTAVDA 311 >gi|47507441|gb|AAH71048.1| MGC83856 protein [Xenopus laevis] Length = 445 Score = 173 bits (439), Expect = 1e-42, Method: Composition-based stats. Identities = 74/80 (92%), Positives = 77/80 (96%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK ITVSQVSNWFGNKRIRYK Sbjct: 237 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYK 296 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 297 KNIGKFQEEANIYAVKTAVS 316 >gi|50795297|ref|XP_423764.1| PREDICTED: similar to pre-B-cell leukemia transcription factor 3 [Gallus gallus] Length = 431 Score = 173 bits (439), Expect = 1e-42, Method: Composition-based stats. Identities = 76/81 (93%), Positives = 79/81 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 238 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKGGITVSQVSNWFGNKRIRYK 297 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KN+GKFQEEANIYAAKTAV A Sbjct: 298 KNMGKFQEEANIYAAKTAVDA 318 >gi|46048897|ref|NP_990077.1| PBX1A protein [Gallus gallus] PBX1A [Gallus gallus] Length = 430 Score = 173 bits (438), Expect = 1e-42, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 233 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 292 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 293 KNIGKFQEEANIYAAKTAVTA 313 >gi|34365779|ref|NP_899198.1| pre B-cell leukemia transcription factor 1 isoform a [Mus musculus] PREDICTED: similar to Pre-B-cell leukemia transcription factor-1 (Homeobox protein PBX1) [Rattus norvegicus] pre-B-cell leukemia transcription factor 1 [Homo sapiens] pre-B-cell leukemia transcription factor 1 [Homo sapiens] pre-B-cell leukemia transcription factor 1 [Homo sapiens] Pre B-cell leukemia transcription factor 1, isoform a [Mus musculus] Pre-B-cell leukemia transcription factor-1 (Homeobox protein PBX1) Pre-B-cell leukemia transcription factor-1 (Homeobox protein PBX1) (Homeobox protein PRL) PBX1 [Homo sapiens] pre-B-cell leukemia transcription factor 1 [Homo sapiens] PBX1a [Mus musculus] PBX1a Length = 430 Score = 172 bits (437), Expect = 2e-42, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 233 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 292 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 293 KNIGKFQEEANIYAAKTAVTA 313 >gi|56388825|gb|AAH87615.1| Pre B-cell leukemia transcription factor 2 [Mus musculus] Length = 430 Score = 171 bits (434), Expect = 5e-42, Method: Composition-based stats. Identities = 75/80 (93%), Positives = 78/80 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 244 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 303 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 304 KNIGKFQEEANIYAVKTAVS 323 >gi|8567384|ref|NP_059491.1| pre B-cell leukemia transcription factor 2 [Mus musculus] PBX2 [Mus musculus] Pre B-cell leukemia transcription factor 2 [Mus musculus] Pre B-cell leukemia transcription factor 2 [Mus musculus] Pre-B-cell leukemia transcription factor-2 (Homeobox protein PBX2) PBX2 [Mus musculus] Length = 430 Score = 171 bits (433), Expect = 5e-42, Method: Composition-based stats. Identities = 75/80 (93%), Positives = 78/80 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 244 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 303 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 304 KNIGKFQEEANIYAVKTAVS 323 >gi|50657366|ref|NP_001002828.1| pre-B-cell leukemia transcription factor 2 [Rattus norvegicus] pre-B-cell leukemia transcription factor 2 [Rattus norvegicus] Length = 430 Score = 171 bits (433), Expect = 6e-42, Method: Composition-based stats. Identities = 75/80 (93%), Positives = 78/80 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 244 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 303 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 304 KNIGKFQEEANIYAVKTAVS 323 >gi|7160800|emb|CAB76458.1| Pbx4/Lazarus homeodomain protein [Danio rerio] Pbx4 homeodomain protein [Danio rerio] pre-B-cell leukemia transcription factor 4 [Danio rerio] Length = 343 Score = 170 bits (432), Expect = 7e-42, Method: Composition-based stats. Identities = 76/81 (93%), Positives = 78/81 (96%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 231 ARRKRRNFNKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 290 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEAN+YA KTAV A Sbjct: 291 KNIGKFQEEANLYAVKTAVDA 311 >gi|47228232|emb|CAG07627.1| unnamed protein product [Tetraodon nigroviridis] Length = 338 Score = 170 bits (431), Expect = 1e-41, Method: Composition-based stats. Identities = 72/78 (92%), Positives = 77/78 (98%) Query: 5 KRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYKKNI 64 +RRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITV+QVSNWFGNKRIRYKKNI Sbjct: 144 QRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVAQVSNWFGNKRIRYKKNI 203 Query: 65 GKFQEEANIYAAKTAVTA 82 GKFQEEAN+YAA+TAV+A Sbjct: 204 GKFQEEANMYAARTAVSA 221 >gi|7160798|emb|CAB76457.1| pbxy homeodomain protein [Danio rerio] pre-B-cell leukemia transcription factor y [Danio rerio] Length = 403 Score = 170 bits (431), Expect = 1e-41, Method: Composition-based stats. Identities = 71/81 (87%), Positives = 77/81 (95%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAK+ ITVSQVSNWFGNKRIRYK Sbjct: 252 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKQCSITVSQVSNWFGNKRIRYK 311 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGK+QEEAN+YA KTA+ A Sbjct: 312 KNIGKYQEEANLYAMKTALGA 332 >gi|55626238|ref|XP_518378.1| PREDICTED: similar to Pre-B-cell leukemia transcription factor-2 (Homeobox protein PBX2) (G17 protein) [Pan troglodytes] Length = 413 Score = 169 bits (429), Expect = 2e-41, Method: Composition-based stats. Identities = 75/80 (93%), Positives = 78/80 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 227 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 286 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 287 KNIGKFQEEANIYAVKTAVS 306 >gi|55588664|ref|XP_513961.1| PREDICTED: hypothetical protein XP_513961 [Pan troglodytes] Length = 351 Score = 169 bits (429), Expect = 2e-41, Method: Composition-based stats. Identities = 80/81 (98%), Positives = 80/81 (98%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 128 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 187 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEANIYAAKTAVTA Sbjct: 188 KNIGKFQEEANIYAAKTAVTA 208 >gi|47207681|emb|CAF91499.1| unnamed protein product [Tetraodon nigroviridis] Length = 382 Score = 169 bits (429), Expect = 2e-41, Method: Composition-based stats. Identities = 71/81 (87%), Positives = 76/81 (93%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAK+ ITVSQVSNWFGNKRIRYK Sbjct: 231 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKQCAITVSQVSNWFGNKRIRYK 290 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNI KFQEEAN+YA KTA+ A Sbjct: 291 KNISKFQEEANLYAMKTALGA 311 >gi|31228972|ref|XP_318146.1| ENSANGP00000020686 [Anopheles gambiae str. PEST] ENSANGP00000020686 [Anopheles gambiae str. PEST] Length = 375 Score = 169 bits (429), Expect = 2e-41, Method: Composition-based stats. Identities = 72/81 (88%), Positives = 76/81 (93%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQA+EILNEYFYSHLSNPYPSEEAKEELA+K GITVSQVSNWFGNKRIRYK Sbjct: 239 ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYK 298 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGK QEEAN+YAAK A A Sbjct: 299 KNIGKAQEEANLYAAKKAAGA 319 >gi|7160792|emb|CAB76454.1| Pbx1a homeodomain protein [Danio rerio] Pre-B-cell leukemia transcription factor 1a, isoform 1 [Danio rerio] pre-B-cell leukemia transcription factor 1a isoform 1 [Danio rerio] Length = 428 Score = 169 bits (428), Expect = 2e-41, Method: Composition-based stats. Identities = 75/81 (92%), Positives = 77/81 (95%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKK ITVSQVSNWFGNKRIRYK Sbjct: 232 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYK 291 Query: 62 KNIGKFQEEANIYAAKTAVTA 82 KNIGKFQEEAN+YAA+TA A Sbjct: 292 KNIGKFQEEANMYAARTAANA 312 >gi|35313|emb|CAA42503.1| homeobox protein [Homo sapiens] Length = 430 Score = 169 bits (428), Expect = 2e-41, Method: Composition-based stats. Identities = 75/80 (93%), Positives = 78/80 (97%) Query: 2 ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKSGITVSQVSNWFGNKRIRYK 61 ARRKRRNF+KQATE+LNEYFYSHLSNPYPSEEAKEELAKK GITVSQVSNWFGNKRIRYK Sbjct: 244 ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYK 303 Query: 62 KNIGKFQEEANIYAAKTAVT 81 KNIGKFQEEANIYA KTAV+ Sbjct: 304 KNIGKFQEEANIYAVKTAVS 323 Database: nr27062005 Posted date: Jul 21, 2005 1:35 PM Number of letters in database: 863,360,394 Number of sequences in database: 2,540,612 Lambda K H 0.308 0.147 0.452 Lambda K H 0.267 0.0447 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 292,555,443 Number of Sequences: 2540612 Number of extensions: 11149436 Number of successful extensions: 37418 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 6500 Number of HSP's successfully gapped in prelim test: 3086 Number of HSP's that attempted gapping in prelim test: 30186 Number of HSP's gapped (non-prelim): 10183 length of query: 82 length of database: 863,360,394 effective HSP length: 53 effective length of query: 29 effective length of database: 728,707,958 effective search space: 21132530782 effective search space used: 21132530782 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.4 bits) S2: 69 (31.1 bits)